SCOP 1.69: Domain d1x7fa1: 1x7f A:245-361

Lineage for d1x7fa1 (1x7f A:245-361)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (2 families)

5. Family b.62.1.2: Outer surface protein, C-terminal domain [110278] (1 protein)
   lacks the N-terminal strand of cyclophilin but the beta-barrel (7,10) remains closed; corresponds to the C-terminal part of Pfam 05913

6. Protein Outer surface protein, C-terminal domain [110279] (1 species)

7. Species Bacillus cereus [TaxId:1396] [110280] (1 PDB entry)

8. Domain d1x7fa1: 1x7f A:245-361 [109498]
   Other proteins in same PDB: d1x7fa2

Details for d1x7fa1

PDB Entry: 1x7f, 2.3 Å

PDB Description: crystal structure of an uncharacterized b. cereus protein

SCOP Domain Sequences for d1x7fa1:

Sequence; same for both SEQRES and ATOM records:

>d1x7fa1 b.62.1.2 (A:245-361) Outer surface protein, C-terminal domain {Bacillus cereus}
mlqlkvhfvdeatevekratlqelhvrrgditeymvrstevrkkykdydfpvresvlqer
gqvvignnsfgkykgelqiilkempiderknivgtiaeeelflldyvgawtqftcve

Timeline for d1x7fa1:

• d1x7fa1 is new in SCOP 1.69
  
• d1x7fa1 appears in SCOP 1.71
  
• d1x7fa1 appears in the current release, SCOPe 2.08