Lineage for d1x7fa1 (1x7f A:245-361)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2397365Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2397366Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2397759Family b.62.1.2: Outer surface protein, C-terminal domain [110278] (1 protein)
    lacks the N-terminal strand of cyclophilin but the beta-barrel (7,10) remains closed; corresponds to the C-terminal part of Pfam PF05913
  6. 2397760Protein Outer surface protein, C-terminal domain [110279] (1 species)
  7. 2397761Species Bacillus cereus [TaxId:1396] [110280] (1 PDB entry)
    Uniprot Q81HJ5
  8. 2397762Domain d1x7fa1: 1x7f A:245-361 [109498]
    Other proteins in same PDB: d1x7fa2

Details for d1x7fa1

PDB Entry: 1x7f (more details), 2.3 Å

PDB Description: crystal structure of an uncharacterized b. cereus protein
PDB Compounds: (A:) outer surface protein

SCOPe Domain Sequences for d1x7fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x7fa1 b.62.1.2 (A:245-361) Outer surface protein, C-terminal domain {Bacillus cereus [TaxId: 1396]}
mlqlkvhfvdeatevekratlqelhvrrgditeymvrstevrkkykdydfpvresvlqer
gqvvignnsfgkykgelqiilkempiderknivgtiaeeelflldyvgawtqftcve

SCOPe Domain Coordinates for d1x7fa1:

Click to download the PDB-style file with coordinates for d1x7fa1.
(The format of our PDB-style files is described here.)

Timeline for d1x7fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x7fa2