Lineage for d1x77a_ (1x77 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 481069Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 481332Superfamily c.23.5: Flavoproteins [52218] (7 families) (S)
  5. 481489Family c.23.5.4: NADPH-dependent FMN reductase [89590] (3 proteins)
    Pfam 03358
  6. 481493Protein Hypothetical protein PA1204 [110475] (1 species)
  7. 481494Species Pseudomonas aeruginosa [TaxId:287] [110476] (2 PDB entries)
  8. 481496Domain d1x77a_: 1x77 A: [109496]

Details for d1x77a_

PDB Entry: 1x77 (more details), 2.7 Å

PDB Description: crystal structure of a nad(p)h-dependent fmn reductase complexed with fmn

SCOP Domain Sequences for d1x77a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x77a_ c.23.5.4 (A:) Hypothetical protein PA1204 {Pseudomonas aeruginosa}
ikvlgisgslrsgsynsaalqeaiglvppgmsieladisgiplynedvyalgfppaverf
reqiraadallfatpeynysmagvlknaidwasrppeqpfsgkpaailgasagrfgtara
qyhlrqtlvfldvhplnkpevmissaqnafdaqgrllddkareliqqqlqalql

SCOP Domain Coordinates for d1x77a_:

Click to download the PDB-style file with coordinates for d1x77a_.
(The format of our PDB-style files is described here.)

Timeline for d1x77a_: