SCOPe 2.07: Domain d1x6oa2: 1x6o A:87-165

Lineage for d1x6oa2 (1x6o A:87-165)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
   barrel, closed; n=5, S=8

6. Protein C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) [50296] (5 species)

7. Species Leishmania infantum [TaxId:5671] [110195] (1 PDB entry)
   Uniprot Q9N9V6

8. Domain d1x6oa2: 1x6o A:87-165 [109494]
   Other proteins in same PDB: d1x6oa1
   Structural genomics target
   complexed with peg

Details for d1x6oa2

PDB Entry: 1x6o, 1.6 Å

PDB Description: structural analysis of leishmania braziliensis eukaryotic initiation factor 5a

PDB Compounds: (A:) eukaryotic initiation factor 5a

SCOPe Domain Sequences for d1x6oa2:

Sequence; same for both SEQRES and ATOM records:

>d1x6oa2 b.40.4.5 (A:87-165) C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) {Leishmania infantum [TaxId: 5671]}
vktytysvldiqanedpslpahlslmddegesredldmppdpalatqikeqfdsgkdvlv
vvvsamgteqvlqtknaae

Timeline for d1x6oa2:

• d1x6oa2 first appeared in SCOP 1.69
  
• d1x6oa2 appears in SCOPe 2.06
  
• d1x6oa2 appears in the current release, SCOPe 2.08