Lineage for d1x6oa2 (1x6o A:87-165)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462779Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 463443Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 463711Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (20 proteins)
    barrel, closed; n=5, S=8
  6. 463718Protein C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) [50296] (4 species)
  7. 463728Species Leishmania infantum [TaxId:5671] [110195] (1 PDB entry)
  8. 463729Domain d1x6oa2: 1x6o A:87-165 [109494]
    Other proteins in same PDB: d1x6oa1
    Structural genomics target

Details for d1x6oa2

PDB Entry: 1x6o (more details), 1.6 Å

PDB Description: structural analysis of leishmania braziliensis eukaryotic initiation factor 5a

SCOP Domain Sequences for d1x6oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x6oa2 b.40.4.5 (A:87-165) C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) {Leishmania infantum}
vktytysvldiqanedpslpahlslmddegesredldmppdpalatqikeqfdsgkdvlv
vvvsamgteqvlqtknaae

SCOP Domain Coordinates for d1x6oa2:

Click to download the PDB-style file with coordinates for d1x6oa2.
(The format of our PDB-style files is described here.)

Timeline for d1x6oa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x6oa1