Lineage for d1x6oa2 (1x6o A:87-165)
- Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds) 
Fold b.40: OB-fold [50198] (10 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) 
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (20 proteins)
barrel, closed; n=5, S=8
Protein C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) [50296] (4 species) Species Leishmania infantum [TaxId:5671] [110195] (1 PDB entry) 
Domain d1x6oa2: 1x6o A:87-165 [109494]
Other proteins in same PDB: d1x6oa1
Structural genomics target
Details for d1x6oa2
PDB Entry: 1x6o (more details), 1.6 Å
PDB Description: structural analysis of leishmania braziliensis eukaryotic initiation factor 5a
SCOP Domain Sequences for d1x6oa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x6oa2 b.40.4.5 (A:87-165) C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) {Leishmania infantum}
vktytysvldiqanedpslpahlslmddegesredldmppdpalatqikeqfdsgkdvlv
vvvsamgteqvlqtknaae
SCOP Domain Coordinates for d1x6oa2:
Click to download the PDB-style file with coordinates for d1x6oa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1x6oa2:
- d1x6oa2 is new in SCOP 1.69
- d1x6oa2 appears in SCOP 1.71
- d1x6oa2 appears in the current release, SCOPe 2.08
View in 3D
