![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
![]() | Protein C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) [50296] (5 species) |
![]() | Species Leishmania infantum [TaxId:5671] [110195] (1 PDB entry) Uniprot Q9N9V6 |
![]() | Domain d1x6oa2: 1x6o A:87-165 [109494] Other proteins in same PDB: d1x6oa1 Structural genomics target complexed with peg has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1x6o (more details), 1.6 Å
SCOPe Domain Sequences for d1x6oa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x6oa2 b.40.4.5 (A:87-165) C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) {Leishmania infantum [TaxId: 5671]} vktytysvldiqanedpslpahlslmddegesredldmppdpalatqikeqfdsgkdvlv vvvsamgteqvlqtknaae
Timeline for d1x6oa2: