SCOP 1.71: Domain d1x6oa1: 1x6o A:19-86

Lineage for d1x6oa1 (1x6o A:19-86)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.34: SH3-like barrel [50036] (15 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families)
   many known members contain KOW motif

5. Family b.34.5.2: eIF5a N-terminal domain-like [50110] (3 proteins)

6. Protein Eukaryotic initiation translation factor 5a (eIF5a) [50111] (5 species)

7. Species Leishmania infantum [TaxId:5671] [110169] (1 PDB entry)

8. Domain d1x6oa1: 1x6o A:19-86 [109493]
   Other proteins in same PDB: d1x6oa2
   Structural genomics target
   complexed with peg

Details for d1x6oa1

PDB Entry: 1x6o, 1.6 Å

PDB Description: structural analysis of leishmania braziliensis eukaryotic initiation factor 5a

SCOP Domain Sequences for d1x6oa1:

Sequence, based on SEQRES records:

>d1x6oa1 b.34.5.2 (A:19-86) Eukaryotic initiation translation factor 5a (eIF5a) {Leishmania infantum}
ktyplaagalkkggyvcingrpckvidlsvsktgkhghakvsivatdiftgnrledqaps
thnvevpf

Sequence, based on observed residues (ATOM records):

>d1x6oa1 b.34.5.2 (A:19-86) Eukaryotic initiation translation factor 5a (eIF5a) {Leishmania infantum}
ktyplaagalkkggyvcingrpckvidlsvskthakvsivatdiftgnrledqapsthnv
evpf

Timeline for d1x6oa1:

• d1x6oa1 first appeared in SCOP 1.69
  
• d1x6oa1 appears in SCOP 1.73
  
• d1x6oa1 appears in the current release, SCOPe 2.08