Lineage for d1x6oa1 (1x6o A:19-86)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. Family b.34.5.2: eIF5a N-terminal domain-like [50110] (4 proteins)
  6. Protein Eukaryotic initiation translation factor 5a (eIF5a) [50111] (5 species)
  7. Species Leishmania infantum [TaxId:5671] [110169] (1 PDB entry)
    Uniprot Q9N9V6
  8. Domain d1x6oa1: 1x6o A:19-86 [109493]
    Other proteins in same PDB: d1x6oa2
    Structural genomics target
    complexed with peg

Details for d1x6oa1

PDB Entry: 1x6o (more details), 1.6 Å

PDB Description: structural analysis of leishmania braziliensis eukaryotic initiation factor 5a
PDB Compounds: (A:) eukaryotic initiation factor 5a

SCOPe Domain Sequences for d1x6oa1:

Sequence, based on SEQRES records: (download)

>d1x6oa1 b.34.5.2 (A:19-86) Eukaryotic initiation translation factor 5a (eIF5a) {Leishmania infantum [TaxId: 5671]}
ktyplaagalkkggyvcingrpckvidlsvsktgkhghakvsivatdiftgnrledqaps
thnvevpf

Sequence, based on observed residues (ATOM records): (download)

>d1x6oa1 b.34.5.2 (A:19-86) Eukaryotic initiation translation factor 5a (eIF5a) {Leishmania infantum [TaxId: 5671]}
ktyplaagalkkggyvcingrpckvidlsvskthakvsivatdiftgnrledqapsthnv
evpf

SCOPe Domain Coordinates for d1x6oa1 are not available.

Timeline for d1x6oa1:

Domains from same chain:
(mouse over for more information)
d1x6oa2