![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) ![]() many known members contain KOW motif |
![]() | Family b.34.5.2: eIF5a N-terminal domain-like [50110] (4 proteins) |
![]() | Protein Eukaryotic initiation translation factor 5a (eIF5a) [50111] (5 species) |
![]() | Species Leishmania infantum [TaxId:5671] [110169] (1 PDB entry) Uniprot Q9N9V6 |
![]() | Domain d1x6oa1: 1x6o A:19-86 [109493] Other proteins in same PDB: d1x6oa2 Structural genomics target complexed with peg |
PDB Entry: 1x6o (more details), 1.6 Å
SCOPe Domain Sequences for d1x6oa1:
Sequence, based on SEQRES records: (download)
>d1x6oa1 b.34.5.2 (A:19-86) Eukaryotic initiation translation factor 5a (eIF5a) {Leishmania infantum [TaxId: 5671]} ktyplaagalkkggyvcingrpckvidlsvsktgkhghakvsivatdiftgnrledqaps thnvevpf
>d1x6oa1 b.34.5.2 (A:19-86) Eukaryotic initiation translation factor 5a (eIF5a) {Leishmania infantum [TaxId: 5671]} ktyplaagalkkggyvcingrpckvidlsvskthakvsivatdiftgnrledqapsthnv evpf
Timeline for d1x6oa1: