SCOP 1.73: Domain d1wplp_: 1wpl P:

Lineage for d1wplp_ (1wpl P:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.205: GTP cyclohydrolase I feedback regulatory protein, GFRP [69760] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta, antiparallel beta-sheet: order 342165

4. Superfamily d.205.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69761] (1 family)

5. Family d.205.1.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69762] (1 protein)

6. Protein GTP cyclohydrolase I feedback regulatory protein, GFRP [69763] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [69764] (4 PDB entries)

8. Domain d1wplp_: 1wpl P: [109487]
   Other proteins in same PDB: d1wpla_, d1wplb_, d1wplc_, d1wpld_, d1wple_, d1wplf_, d1wplg_, d1wplh_, d1wpli_, d1wplj_

Details for d1wplp_

PDB Entry: 1wpl, 2.8 Å

PDB Description: Crystal structure of the inhibitory form of rat GTP cyclohydrolase I/GFRP complex

PDB Compounds: (P:) GTP Cyclohydrolase I Feedback Regulatory Protein

SCOP Domain Sequences for d1wplp_:

Sequence; same for both SEQRES and ATOM records:

>d1wplp_ d.205.1.1 (P:) GTP cyclohydrolase I feedback regulatory protein, GFRP {Rat (Rattus norvegicus) [TaxId: 10116]}
mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
ecrgfrvlsmtgvgqtlvwclhke

Timeline for d1wplp_:

• d1wplp_ first appeared in SCOP 1.69
  
• d1wplp_ appears in SCOP 1.71
  
• d1wplp_ appears in SCOP 1.75
  
• d1wplp_ appears in the current release, SCOPe 2.08