Lineage for d1wpln_ (1wpl N:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1050626Fold d.205: GTP cyclohydrolase I feedback regulatory protein, GFRP [69760] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta, antiparallel beta-sheet: order 342165
  4. 1050627Superfamily d.205.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69761] (1 family) (S)
  5. 1050628Family d.205.1.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69762] (1 protein)
  6. 1050629Protein GTP cyclohydrolase I feedback regulatory protein, GFRP [69763] (1 species)
  7. 1050630Species Norway rat (Rattus norvegicus) [TaxId:10116] [69764] (4 PDB entries)
    Uniprot P70552
  8. 1050639Domain d1wpln_: 1wpl N: [109485]
    Other proteins in same PDB: d1wpla_, d1wplb_, d1wplc_, d1wpld_, d1wple_, d1wplf_, d1wplg_, d1wplh_, d1wpli_, d1wplj_
    complexed with 3po, hbi, na, zn

Details for d1wpln_

PDB Entry: 1wpl (more details), 2.8 Å

PDB Description: Crystal structure of the inhibitory form of rat GTP cyclohydrolase I/GFRP complex
PDB Compounds: (N:) GTP Cyclohydrolase I Feedback Regulatory Protein

SCOPe Domain Sequences for d1wpln_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpln_ d.205.1.1 (N:) GTP cyclohydrolase I feedback regulatory protein, GFRP {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
ecrgfrvlsmtgvgqtlvwclhke

SCOPe Domain Coordinates for d1wpln_:

Click to download the PDB-style file with coordinates for d1wpln_.
(The format of our PDB-style files is described here.)

Timeline for d1wpln_: