Lineage for d1wpll_ (1wpl L:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 515807Fold d.205: GTP cyclohydrolase I feedback regulatory protein, GFRP [69760] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta, antiparallel beta-sheet: order 342165
  4. 515808Superfamily d.205.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69761] (1 family) (S)
  5. 515809Family d.205.1.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69762] (1 protein)
  6. 515810Protein GTP cyclohydrolase I feedback regulatory protein, GFRP [69763] (1 species)
  7. 515811Species Rat (Rattus norvegicus) [TaxId:10116] [69764] (4 PDB entries)
  8. 515828Domain d1wpll_: 1wpl L: [109483]
    Other proteins in same PDB: d1wpla_, d1wplb_, d1wplc_, d1wpld_, d1wple_, d1wplf_, d1wplg_, d1wplh_, d1wpli_, d1wplj_

Details for d1wpll_

PDB Entry: 1wpl (more details), 2.8 Å

PDB Description: Crystal structure of the inhibitory form of rat GTP cyclohydrolase I/GFRP complex

SCOP Domain Sequences for d1wpll_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpll_ d.205.1.1 (L:) GTP cyclohydrolase I feedback regulatory protein, GFRP {Rat (Rattus norvegicus)}
mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
ecrgfrvlsmtgvgqtlvwclhke

SCOP Domain Coordinates for d1wpll_:

Click to download the PDB-style file with coordinates for d1wpll_.
(The format of our PDB-style files is described here.)

Timeline for d1wpll_: