Lineage for d1wplf_ (1wpl F:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1035940Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 1035941Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 1035942Family d.96.1.1: GTP cyclohydrolase I [55621] (1 protein)
  6. 1035943Protein GTP cyclohydrolase I [55622] (4 species)
    beta-sheets of five subunits form a barrel, closed: n=20, S=20
  7. 1036056Species Norway rat (Rattus norvegicus) [TaxId:10116] [69790] (3 PDB entries)
    Uniprot P22288
  8. 1036062Domain d1wplf_: 1wpl F: [109477]
    Other proteins in same PDB: d1wplk_, d1wpll_, d1wplm_, d1wpln_, d1wplo_, d1wplp_, d1wplq_, d1wplr_, d1wpls_, d1wplt_
    complexed with 3po, hbi, na, zn

Details for d1wplf_

PDB Entry: 1wpl (more details), 2.8 Å

PDB Description: Crystal structure of the inhibitory form of rat GTP cyclohydrolase I/GFRP complex
PDB Compounds: (F:) GTP cyclohydrolase I

SCOPe Domain Sequences for d1wplf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wplf_ d.96.1.1 (F:) GTP cyclohydrolase I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv
lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys
rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgvqkmnsktvtstmlgvfre
dpktreefltlirs

SCOPe Domain Coordinates for d1wplf_:

Click to download the PDB-style file with coordinates for d1wplf_.
(The format of our PDB-style files is described here.)

Timeline for d1wplf_: