![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
![]() | Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) ![]() bind purine or pterin in topologically similar sites between subunits |
![]() | Family d.96.1.1: GTP cyclohydrolase I [55621] (2 proteins) |
![]() | Protein GTP cyclohydrolase I [55622] (4 species) beta-sheets of five subunits form a barrel, closed: n=20, S=20 |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [69790] (3 PDB entries) Uniprot P22288 |
![]() | Domain d1wplb_: 1wpl B: [109473] Other proteins in same PDB: d1wplk_, d1wpll_, d1wplm_, d1wpln_, d1wplo_, d1wplp_, d1wplq_, d1wplr_, d1wpls_, d1wplt_ complexed with 3po, hbi, na, zn |
PDB Entry: 1wpl (more details), 2.8 Å
SCOPe Domain Sequences for d1wplb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wplb_ d.96.1.1 (B:) GTP cyclohydrolase I {Norway rat (Rattus norvegicus) [TaxId: 10116]} rprseednelnlpnlaaayssilrslgedpqrqgllktpwraatamqfftkgyqetisdv lndaifdedhdemvivkdidmfsmcehhlvpfvgrvhigylpnkqvlglsklariveiys rrlqvqerltkqiavaitealqpagvgvvieathmcmvmrgvqkmnsktvtstmlgvfre dpktreefltlirs
Timeline for d1wplb_: