Lineage for d1wosa2 (1wos A:1-278)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 516715Fold d.250: Aminomethyltransferase folate-binding domain [103024] (1 superfamily)
    duplication: consists of two beta(2)-alpha-beta(3)-alpha subdomains swapped with the first strands
  4. 516716Superfamily d.250.1: Aminomethyltransferase folate-binding domain [103025] (1 family) (S)
    some topological similarity to Formylmethanofuran:tetrahydromethanopterin formyltransferase
  5. 516717Family d.250.1.1: Aminomethyltransferase folate-binding domain [103026] (3 proteins)
  6. 516718Protein Glycine cleavage system T protein, GcvT [111012] (2 species)
  7. 516721Species Thermotoga maritima [TaxId:243274] [111013] (4 PDB entries)
  8. 516722Domain d1wosa2: 1wos A:1-278 [109469]
    Other proteins in same PDB: d1wosa1

Details for d1wosa2

PDB Entry: 1wos (more details), 1.84 Å

PDB Description: Crystal Structure of T-protein of the Glycine Cleavage System

SCOP Domain Sequences for d1wosa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wosa2 d.250.1.1 (A:1-278) Glycine cleavage system T protein, GcvT {Thermotoga maritima}
mkrtplfekhvelgakmvdfagwemplyytsifeevmavrksvgmfdvshmgeflvkgpe
avsfidflitndfsslpdgkaiysvmcnenggiiddlvvykvspdealmvvnaaniekdf
nwikshsknfdvevsnisdttaliafqgpkaqetlqelvedgleeiayysfrksivagve
tlvsrtgytgedgfelmleaknapkvwdalmnllrkidgrpaglgardvcrleatyllyg
qdmdentnpfevglswvvklnkdfvgkeallkakekve

SCOP Domain Coordinates for d1wosa2:

Click to download the PDB-style file with coordinates for d1wosa2.
(The format of our PDB-style files is described here.)

Timeline for d1wosa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wosa1