SCOPe 2.06: Domain d1wosa1: 1wos A:279-361

Lineage for d1wosa1 (1wos A:279-361)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (2 families)

5. Family b.44.2.1: Aminomethyltransferase beta-barrel domain [101791] (3 proteins)

6. Protein Glycine cleavage system T protein, GcvT [110231] (4 species)

7. Species Thermotoga maritima [TaxId:2336] [110232] (4 PDB entries)
   Uniprot Q9WY54

8. Domain d1wosa1: 1wos A:279-361 [109468]
   Other proteins in same PDB: d1wosa2

Details for d1wosa1

PDB Entry: 1wos, 1.84 Å

PDB Description: Crystal Structure of T-protein of the Glycine Cleavage System

PDB Compounds: (A:) Aminomethyltransferase

SCOPe Domain Sequences for d1wosa1:

Sequence; same for both SEQRES and ATOM records:

>d1wosa1 b.44.2.1 (A:279-361) Glycine cleavage system T protein, GcvT {Thermotoga maritima [TaxId: 2336]}
rklvalelsgkriarkgyevlkngervgeitsgnfsptlgksialalvsksvkigdqlgv
vfpggklvealvvkkpfyrgsvr

Timeline for d1wosa1:

• d1wosa1 first appeared in SCOP 1.69
  
• d1wosa1 appears in SCOPe 2.05
  
• d1wosa1 appears in SCOPe 2.07
  
• d1wosa1 appears in the current release, SCOPe 2.08