Class b: All beta proteins [48724] (149 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (1 family) |
Family b.44.2.1: Aminomethyltransferase beta-barrel domain [101791] (3 proteins) |
Protein Glycine cleavage system T protein, GcvT [110231] (3 species) |
Species Thermotoga maritima [TaxId:243274] [110232] (4 PDB entries) |
Domain d1wora1: 1wor A:279-362 [109466] Other proteins in same PDB: d1wora2 complexed with red |
PDB Entry: 1wor (more details), 1.95 Å
SCOP Domain Sequences for d1wora1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wora1 b.44.2.1 (A:279-362) Glycine cleavage system T protein, GcvT {Thermotoga maritima} rklvalelsgkriarkgyevlkngervgeitsgnfsptlgksialalvsksvkigdqlgv vfpggklvealvvkkpfyrgsvrr
Timeline for d1wora1: