Lineage for d1woqb2 (1woq B:140-263)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 488062Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 488063Superfamily c.55.1: Actin-like ATPase domain [53067] (10 families) (S)
    duplication contains two domains of this fold
  5. 488383Family c.55.1.10: ROK (Pfam 00480) [110636] (1 protein)
  6. 488384Protein Inorganic polyphosphate/ATP-glucomannokinase PPGMK [110637] (1 species)
  7. 488385Species Arthrobacter sp. strain KM [110638] (1 PDB entry)
  8. 488389Domain d1woqb2: 1woq B:140-263 [109465]

Details for d1woqb2

PDB Entry: 1woq (more details), 1.8 Å

PDB Description: Crystal Structure of Inorganic Polyphosphate/ATP-Glucomannokinase From Arthrobacter sp. strain KM At 1.8 A Resolution

SCOP Domain Sequences for d1woqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1woqb2 c.55.1.10 (B:140-263) Inorganic polyphosphate/ATP-glucomannokinase PPGMK {Arthrobacter sp. strain KM}
vkgtvlvitlgtgigsafifdgklvpnaelghleidghdaetkasavarerdglswdeys
vllqryfshveflfspelfivgggiskradeylpnlrlrtpivpavlrneagivgaaiei
alqh

SCOP Domain Coordinates for d1woqb2:

Click to download the PDB-style file with coordinates for d1woqb2.
(The format of our PDB-style files is described here.)

Timeline for d1woqb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1woqb1