Lineage for d1woqa1 (1woq A:11-139)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1373176Family c.55.1.10: ROK [110636] (8 proteins)
    Pfam PF00480
  6. 1373181Protein Inorganic polyphosphate/ATP-glucomannokinase PPGMK [110637] (1 species)
  7. 1373182Species Arthrobacter sp. KM [TaxId:184230] [110638] (1 PDB entry)
    Uniprot Q7WT42 11-263 # Fragment
  8. 1373183Domain d1woqa1: 1woq A:11-139 [109462]
    complexed with bgc, po4

Details for d1woqa1

PDB Entry: 1woq (more details), 1.8 Å

PDB Description: crystal structure of inorganic polyphosphate/atp-glucomannokinase from arthrobacter sp. strain km at 1.8 a resolution
PDB Compounds: (A:) Inorganic polyphosphate/ATP-glucomannokinase

SCOPe Domain Sequences for d1woqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1woqa1 c.55.1.10 (A:11-139) Inorganic polyphosphate/ATP-glucomannokinase PPGMK {Arthrobacter sp. KM [TaxId: 184230]}
napligidiggtgikggivdlkkgkllgerfrvptpqpatpesvaeavalvvaelsarpe
apaagspvgvtfpgiiqhgvvhsaanvdkswlntdidalltarlgrpvevindadaagla
earygagag

SCOPe Domain Coordinates for d1woqa1:

Click to download the PDB-style file with coordinates for d1woqa1.
(The format of our PDB-style files is described here.)

Timeline for d1woqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1woqa2