Lineage for d1wopa2 (1wop A:1-278)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 740899Fold d.250: Folate-binding domain [103024] (1 superfamily)
    duplication: consists of two beta(2)-alpha-beta(3)-alpha subdomains swapped with the first strands
  4. 740900Superfamily d.250.1: Folate-binding domain [103025] (2 families) (S)
    some topological similarity to Formylmethanofuran:tetrahydromethanopterin formyltransferase
  5. 740901Family d.250.1.1: Aminomethyltransferase folate-binding domain [103026] (3 proteins)
  6. 740902Protein Glycine cleavage system T protein, GcvT [111012] (3 species)
  7. 740908Species Thermotoga maritima [TaxId:2336] [111013] (4 PDB entries)
  8. 740911Domain d1wopa2: 1wop A:1-278 [109461]
    Other proteins in same PDB: d1wopa1
    complexed with fon

Details for d1wopa2

PDB Entry: 1wop (more details), 2 Å

PDB Description: Crystal Structure of T-protein of the Glycine Cleavage System
PDB Compounds: (A:) Aminomethyltransferase

SCOP Domain Sequences for d1wopa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wopa2 d.250.1.1 (A:1-278) Glycine cleavage system T protein, GcvT {Thermotoga maritima [TaxId: 2336]}
mkrtplfekhvelgakmvdfagwemplyytsifeevmavrksvgmfdvshmgeflvkgpe
avsfidflitndfsslpdgkaiysvmcnenggiiddlvvykvspdealmvvnaaniekdf
nwikshsknfdvevsnisdttaliafqgpkaqetlqelvedgleeiayysfrksivagve
tlvsrtgytgedgfelmleaknapkvwdalmnllrkidgrpaglgardvcrleatyllyg
qdmdentnpfevglswvvklnkdfvgkeallkakekve

SCOP Domain Coordinates for d1wopa2:

Click to download the PDB-style file with coordinates for d1wopa2.
(The format of our PDB-style files is described here.)

Timeline for d1wopa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wopa1