Lineage for d1wooa2 (1woo A:1-278)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1946403Fold d.250: Folate-binding domain [103024] (1 superfamily)
    duplication: consists of two beta(2)-alpha-beta(3)-alpha subdomains swapped with the first strands
  4. 1946404Superfamily d.250.1: Folate-binding domain [103025] (2 families) (S)
    some topological similarity to Formylmethanofuran:tetrahydromethanopterin formyltransferase
  5. 1946405Family d.250.1.1: Aminomethyltransferase folate-binding domain [103026] (4 proteins)
  6. 1946406Protein Glycine cleavage system T protein, GcvT [111012] (4 species)
  7. 1946415Species Thermotoga maritima [TaxId:2336] [111013] (4 PDB entries)
    Uniprot Q9WY54
  8. 1946419Domain d1wooa2: 1woo A:1-278 [109459]
    Other proteins in same PDB: d1wooa1
    complexed with thg

Details for d1wooa2

PDB Entry: 1woo (more details), 2.4 Å

PDB Description: Crystal structure of T-protein of the Glycine Cleavage System
PDB Compounds: (A:) Aminomethyltransferase

SCOPe Domain Sequences for d1wooa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wooa2 d.250.1.1 (A:1-278) Glycine cleavage system T protein, GcvT {Thermotoga maritima [TaxId: 2336]}
mkrtplfekhvelgakmvdfagwemplyytsifeevmavrksvgmfdvshmgeflvkgpe
avsfidflitndfsslpdgkaiysvmcnenggiiddlvvykvspdealmvvnaaniekdf
nwikshsknfdvevsnisdttaliafqgpkaqetlqelvedgleeiayysfrksivagve
tlvsrtgytgedgfelmleaknapkvwdalmnllrkidgrpaglgardvcrleatyllyg
qdmdentnpfevglswvvklnkdfvgkeallkakekve

SCOPe Domain Coordinates for d1wooa2:

Click to download the PDB-style file with coordinates for d1wooa2.
(The format of our PDB-style files is described here.)

Timeline for d1wooa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wooa1