Lineage for d1wooa1 (1woo A:279-362)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464914Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 464975Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (1 family) (S)
  5. 464976Family b.44.2.1: Aminomethyltransferase beta-barrel domain [101791] (3 proteins)
  6. 464977Protein Glycine cleavage system T protein, GcvT [110231] (2 species)
  7. 464980Species Thermotoga maritima [TaxId:243274] [110232] (4 PDB entries)
  8. 464984Domain d1wooa1: 1woo A:279-362 [109458]
    Other proteins in same PDB: d1wooa2

Details for d1wooa1

PDB Entry: 1woo (more details), 2.4 Å

PDB Description: Crystal structure of T-protein of the Glycine Cleavage System

SCOP Domain Sequences for d1wooa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wooa1 b.44.2.1 (A:279-362) Glycine cleavage system T protein, GcvT {Thermotoga maritima}
rklvalelsgkriarkgyevlkngervgeitsgnfsptlgksialalvsksvkigdqlgv
vfpggklvealvvkkpfyrgsvrr

SCOP Domain Coordinates for d1wooa1:

Click to download the PDB-style file with coordinates for d1wooa1.
(The format of our PDB-style files is described here.)

Timeline for d1wooa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wooa2