Lineage for d1wooa1 (1woo A:279-362)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
barrel, closed; n=6, S=10; greek-keySuperfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (2 families) 
Family b.44.2.1: Aminomethyltransferase beta-barrel domain [101791] (3 proteins) 
Protein Glycine cleavage system T protein, GcvT [110231] (4 species) 
Species Thermotoga maritima [TaxId:2336] [110232] (4 PDB entries)
Uniprot Q9WY54
Domain d1wooa1: 1woo A:279-362 [109458]
Other proteins in same PDB: d1wooa2
complexed with thg
Details for d1wooa1
PDB Entry: 1woo (more details), 2.4 Å
PDB Description: Crystal structure of T-protein of the Glycine Cleavage System
PDB Compounds: (A:) AminomethyltransferaseSCOPe Domain Sequences for d1wooa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wooa1 b.44.2.1 (A:279-362) Glycine cleavage system T protein, GcvT {Thermotoga maritima [TaxId: 2336]}
rklvalelsgkriarkgyevlkngervgeitsgnfsptlgksialalvsksvkigdqlgv
vfpggklvealvvkkpfyrgsvrr
SCOPe Domain Coordinates for d1wooa1:
Click to download the PDB-style file with coordinates for d1wooa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wooa1:
- d1wooa1 first appeared in SCOP 1.69
- d1wooa1 appears in SCOPe 2.07
View in 3D
