Lineage for d1woie_ (1woi E:)
- Root: SCOP 1.69
Class c: Alpha and beta proteins (a/b) [51349] (136 folds) 
Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456Superfamily c.42.1: Arginase/deacetylase [52768] (2 families) 
Family c.42.1.1: Arginase-like amidino hydrolases [52769] (3 proteins) 
Protein Agmatinase [110585] (1 species) Species Deinococcus radiodurans [TaxId:1299] [110586] (3 PDB entries) 
Domain d1woie_: 1woi E: [109456]
Details for d1woie_
PDB Entry: 1woi (more details), 1.85 Å
PDB Description: Crystal Structure of Agmatinase Reveals Structural Conservation and Inhibition Mechanism of the Ureohydrolase Superfamily
SCOP Domain Sequences for d1woie_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1woie_ c.42.1.1 (E:) Agmatinase {Deinococcus radiodurans}
gpahlpyggiptfaraplvqpdgdwqadvaalgvpfdialgfrpgarfapralreaslrs
vppftgldgktrlqgvtfadagdvilpslepqlahdriteaarqvrgrcrvpvflggdhs
vsypllrafadvpdlhvvqldahldftdtrndtkwsnsspfrracealpnlvhittvglr
glrfdpeavaaararghtiipmddvtadlagvlaqlprgqnvyfsvdvdgfdpavipgts
spepdgltyaqgmkilaaaaanntvvgldlvelapnldptgrsellmarlvmetlcevfd
hvl
SCOP Domain Coordinates for d1woie_:
Click to download the PDB-style file with coordinates for d1woie_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1woie_:
- d1woie_ is new in SCOP 1.69
- d1woie_ appears in SCOP 1.71
- d1woie_ appears in the current release, SCOPe 2.08, called d1woie1
View in 3D
