SCOPe 2.05: Domain d1woia_: 1woi A:

Lineage for d1woia_ (1woi A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456

4. Superfamily c.42.1: Arginase/deacetylase [52768] (3 families)

5. Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
   Pfam PF00491

6. Protein Agmatinase [110585] (1 species)

7. Species Deinococcus radiodurans [TaxId:1299] [110586] (3 PDB entries)
   Uniprot Q9RZ04 # DRA0149

8. Domain d1woia_: 1woi A: [109452]
   complexed with mn

Details for d1woia_

PDB Entry: 1woi, 1.85 Å

PDB Description: Crystal Structure of Agmatinase Reveals Structural Conservation and Inhibition Mechanism of the Ureohydrolase Superfamily

PDB Compounds: (A:) agmatinase

SCOPe Domain Sequences for d1woia_:

Sequence; same for both SEQRES and ATOM records:

>d1woia_ c.42.1.1 (A:) Agmatinase {Deinococcus radiodurans [TaxId: 1299]}
gpahlpyggiptfaraplvqpdgdwqadvaalgvpfdialgfrpgarfapralreaslrs
vppftgldgktrlqgvtfadagdvilpslepqlahdriteaarqvrgrcrvpvflggdhs
vsypllrafadvpdlhvvqldahldftdtrndtkwsnsspfrracealpnlvhittvglr
glrfdpeavaaararghtiipmddvtadlagvlaqlprgqnvyfsvdvdgfdpavipgts
spepdgltyaqgmkilaaaaanntvvgldlvelapnldptgrsellmarlvmetlcevfd
hvl

Timeline for d1woia_:

• d1woia_ first appeared in SCOP 1.69
  
• d1woia_ appears in SCOPe 2.04
  
• d1woia_ is called d1woia1 in SCOPe 2.06
  
• d1woia_ appears in the current release, SCOPe 2.08, called d1woia1