Lineage for d1woia1 (1woi A:3-304)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873861Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2873862Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2873863Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
    Pfam PF00491
  6. 2873864Protein Agmatinase [110585] (1 species)
  7. 2873865Species Deinococcus radiodurans [TaxId:1299] [110586] (3 PDB entries)
    Uniprot Q9RZ04 # DRA0149
  8. 2873878Domain d1woia1: 1woi A:3-304 [109452]
    Other proteins in same PDB: d1woia2, d1woib2, d1woic2, d1woid2, d1woie2, d1woif2
    complexed with mn

Details for d1woia1

PDB Entry: 1woi (more details), 1.85 Å

PDB Description: Crystal Structure of Agmatinase Reveals Structural Conservation and Inhibition Mechanism of the Ureohydrolase Superfamily
PDB Compounds: (A:) agmatinase

SCOPe Domain Sequences for d1woia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1woia1 c.42.1.1 (A:3-304) Agmatinase {Deinococcus radiodurans [TaxId: 1299]}
gpahlpyggiptfaraplvqpdgdwqadvaalgvpfdialgfrpgarfapralreaslrs
vppftgldgktrlqgvtfadagdvilpslepqlahdriteaarqvrgrcrvpvflggdhs
vsypllrafadvpdlhvvqldahldftdtrndtkwsnsspfrracealpnlvhittvglr
glrfdpeavaaararghtiipmddvtadlagvlaqlprgqnvyfsvdvdgfdpavipgts
spepdgltyaqgmkilaaaaanntvvgldlvelapnldptgrsellmarlvmetlcevfd
hv

SCOPe Domain Coordinates for d1woia1:

Click to download the PDB-style file with coordinates for d1woia1.
(The format of our PDB-style files is described here.)

Timeline for d1woia1: