SCOPe 2.08: Domain d1wohe1: 1woh E:3-304

Lineage for d1wohe1 (1woh E:3-304)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456

4. Superfamily c.42.1: Arginase/deacetylase [52768] (3 families)

5. Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
   Pfam PF00491

6. Protein Agmatinase [110585] (1 species)

7. Species Deinococcus radiodurans [TaxId:1299] [110586] (3 PDB entries)
   Uniprot Q9RZ04 # DRA0149

8. Domain d1wohe1: 1woh E:3-304 [109450]
   Other proteins in same PDB: d1woha2, d1wohb2, d1wohc2, d1wohd2, d1wohe2, d1wohf2

Details for d1wohe1

PDB Entry: 1woh, 1.75 Å

PDB Description: Crystal Structure of Agmatinase Reveals Structural Conservation and Inhibition Mechanism of the Ureohydrolase Superfamily

PDB Compounds: (E:) agmatinase

SCOPe Domain Sequences for d1wohe1:

Sequence; same for both SEQRES and ATOM records:

>d1wohe1 c.42.1.1 (E:3-304) Agmatinase {Deinococcus radiodurans [TaxId: 1299]}
gpahlpyggiptfaraplvqpdgdwqadvaalgvpfdialgfrpgarfapralreaslrs
vppftgldgktrlqgvtfadagdvilpslepqlahdriteaarqvrgrcrvpvflggdhs
vsypllrafadvpdlhvvqldahldftdtrndtkwsnsspfrracealpnlvhittvglr
glrfdpeavaaararghtiipmddvtadlagvlaqlprgqnvyfsvdvdgfdpavipgts
spepdgltyaqgmkilaaaaanntvvgldlvelapnldptgrsellmarlvmetlcevfd
hv

Timeline for d1wohe1:

• d1wohe1 first appeared in SCOP 1.69, called d1wohe_
  
• d1wohe1 appears in SCOPe 2.07