Lineage for d1wohd_ (1woh D:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 583911Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 583912Superfamily c.42.1: Arginase/deacetylase [52768] (2 families) (S)
  5. 583913Family c.42.1.1: Arginase-like amidino hydrolases [52769] (4 proteins)
    Pfam 00491
  6. 583914Protein Agmatinase [110585] (1 species)
  7. 583915Species Deinococcus radiodurans [TaxId:1299] [110586] (3 PDB entries)
  8. 583919Domain d1wohd_: 1woh D: [109449]

Details for d1wohd_

PDB Entry: 1woh (more details), 1.75 Å

PDB Description: Crystal Structure of Agmatinase Reveals Structural Conservation and Inhibition Mechanism of the Ureohydrolase Superfamily

SCOP Domain Sequences for d1wohd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wohd_ c.42.1.1 (D:) Agmatinase {Deinococcus radiodurans}
gpahlpyggiptfaraplvqpdgdwqadvaalgvpfdialgfrpgarfapralreaslrs
vppftgldgktrlqgvtfadagdvilpslepqlahdriteaarqvrgrcrvpvflggdhs
vsypllrafadvpdlhvvqldahldftdtrndtkwsnsspfrracealpnlvhittvglr
glrfdpeavaaararghtiipmddvtadlagvlaqlprgqnvyfsvdvdgfdpavipgts
spepdgltyaqgmkilaaaaanntvvgldlvelapnldptgrsellmarlvmetlcevfd
hvl

SCOP Domain Coordinates for d1wohd_:

Click to download the PDB-style file with coordinates for d1wohd_.
(The format of our PDB-style files is described here.)

Timeline for d1wohd_: