SCOP 1.73: Domain d1wogf_: 1wog F:

Lineage for d1wogf_ (1wog F:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456

4. Superfamily c.42.1: Arginase/deacetylase [52768] (2 families)

5. Family c.42.1.1: Arginase-like amidino hydrolases [52769] (4 proteins)
   Pfam PF00491

6. Protein Agmatinase [110585] (1 species)

7. Species Deinococcus radiodurans [TaxId:1299] [110586] (3 PDB entries)

8. Domain d1wogf_: 1wog F: [109445]
   complexed with 16d, mn

Details for d1wogf_

PDB Entry: 1wog, 1.8 Å

PDB Description: Crystal Structure of Agmatinase Reveals Structural Conservation and Inhibition Mechanism of the Ureohydrolase Superfamily

PDB Compounds: (F:) agmatinase

SCOP Domain Sequences for d1wogf_:

Sequence; same for both SEQRES and ATOM records:

>d1wogf_ c.42.1.1 (F:) Agmatinase {Deinococcus radiodurans [TaxId: 1299]}
gpahlpyggiptfaraplvqpdgdwqadvaalgvpfdialgfrpgarfapralreaslrs
vppftgldgktrlqgvtfadagdvilpslepqlahdriteaarqvrgrcrvpvflggdhs
vsypllrafadvpdlhvvqldahldftdtrndtkwsnsspfrracealpnlvhittvglr
glrfdpeavaaararghtiipmddvtadlagvlaqlprgqnvyfsvdvdgfdpavipgts
spepdgltyaqgmkilaaaaanntvvgldlvelapnldptgrsellmarlvmetlcevfd
hvl

Timeline for d1wogf_:

• d1wogf_ first appeared in SCOP 1.69
  
• d1wogf_ appears in SCOP 1.71
  
• d1wogf_ appears in SCOP 1.75
  
• d1wogf_ appears in the current release, SCOPe 2.08, called d1wogf1