SCOPe 2.08: Domain d1wogf1: 1wog F:3-304

Lineage for d1wogf1 (1wog F:3-304)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456

4. Superfamily c.42.1: Arginase/deacetylase [52768] (3 families)

5. Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
   Pfam PF00491

6. Protein Agmatinase [110585] (1 species)

7. Species Deinococcus radiodurans [TaxId:1299] [110586] (3 PDB entries)
   Uniprot Q9RZ04 # DRA0149

8. Domain d1wogf1: 1wog F:3-304 [109445]
   Other proteins in same PDB: d1woga2, d1wogb2, d1wogc2, d1wogd2, d1woge2, d1wogf2
   complexed with 16d, mn

Details for d1wogf1

PDB Entry: 1wog, 1.8 Å

PDB Description: Crystal Structure of Agmatinase Reveals Structural Conservation and Inhibition Mechanism of the Ureohydrolase Superfamily

PDB Compounds: (F:) agmatinase

SCOPe Domain Sequences for d1wogf1:

Sequence; same for both SEQRES and ATOM records:

>d1wogf1 c.42.1.1 (F:3-304) Agmatinase {Deinococcus radiodurans [TaxId: 1299]}
gpahlpyggiptfaraplvqpdgdwqadvaalgvpfdialgfrpgarfapralreaslrs
vppftgldgktrlqgvtfadagdvilpslepqlahdriteaarqvrgrcrvpvflggdhs
vsypllrafadvpdlhvvqldahldftdtrndtkwsnsspfrracealpnlvhittvglr
glrfdpeavaaararghtiipmddvtadlagvlaqlprgqnvyfsvdvdgfdpavipgts
spepdgltyaqgmkilaaaaanntvvgldlvelapnldptgrsellmarlvmetlcevfd
hv

Timeline for d1wogf1:

• d1wogf1 first appeared in SCOP 1.69, called d1wogf_
  
• d1wogf1 appears in SCOPe 2.07