Lineage for d1wnsa2 (1wns A:348-758)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2571153Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2571154Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2571155Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 2571252Protein Family B DNA polymerase [56680] (7 species)
  7. 2571391Species Pyrococcus kodakaraensis [TaxId:311400] [56685] (2 PDB entries)
    Uniprot P56689 1-758 # 93% sequence identity; Thermococcus kodakarensis KOD1 TaxID: 69014
  8. 2571393Domain d1wnsa2: 1wns A:348-758 [109438]
    Other proteins in same PDB: d1wnsa1

Details for d1wnsa2

PDB Entry: 1wns (more details), 3 Å

PDB Description: crystal structure of family b dna polymerase from hyperthermophilic archaeon pyrococcus kodakaraensis kod1
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d1wnsa2:

Sequence, based on SEQRES records: (download)

>d1wnsa2 e.8.1.1 (A:348-758) Family B DNA polymerase {Pyrococcus kodakaraensis [TaxId: 311400]}
stgnlvewfllrkayernelapnkpdekelarrrqsyeggyvkeperglwenivyldfrs
lypsiiithnvspdtlnregckeydvapqvghrfckdfpgfipsllgdlleerqkikkkm
katidpierklldyrqraikilansyygyygyararwyckecaesvtawgreyitmtike
ieekygfkviysdtdgffatipgadaetvkkkameflkyinaklpgaleleyegfykrgf
fvtkkkyavideegkittrgleivrrdwseiaketqarvleallkdgdvekavrivkevt
eklskyevppeklviheqitrdlkdykatgphvavakrlaargvkirpgtvisyivlkgs
grigdraipfdefdptkhkydaeyyienqvlpaverilrafgyrkedlryq

Sequence, based on observed residues (ATOM records): (download)

>d1wnsa2 e.8.1.1 (A:348-758) Family B DNA polymerase {Pyrococcus kodakaraensis [TaxId: 311400]}
stgnlvewfllrkayernelapnkpdekelarrrqsyeggyvkeperglwenivyldfrs
lypsiiithnvspdtlnregckeydvapqvghrfckdfpgfipsllgdlleerqkikkkm
katidpierklldyrqraikilansyygyygyararwyckecaesvtawgreyitmtike
ieekygfkviysdtdgffatipgadaetvkkkameflkyinaklpgaleleyegfykrgf
fvtkkkyavideegkittrgleivrrdwseiaketqarvleallkdgdvekavrivkevt
eklskyevppeklviheqiphvavakrlaatvisyivlraipfdefdptkhkydaeyyie
nqvlpaverilrgyrkedlryq

SCOPe Domain Coordinates for d1wnsa2:

Click to download the PDB-style file with coordinates for d1wnsa2.
(The format of our PDB-style files is described here.)

Timeline for d1wnsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wnsa1