Lineage for d1wnsa1 (1wns A:1-347)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886484Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2886496Protein Exonuclease domain of family B DNA polymerases [53125] (8 species)
    elaborated with additional structures and the N-terminal subdomain
  7. 2886643Species Pyrococcus kodakaraensis [TaxId:311400] [53131] (2 PDB entries)
    Uniprot P56689 1-758 # 93% sequence identity; Thermococcus kodakarensis KOD1 TaxID: 69014
    additional N-terminal subdomain contains rudimental OB-fold but complete ferredoxin-like fold
  8. 2886645Domain d1wnsa1: 1wns A:1-347 [109437]
    Other proteins in same PDB: d1wnsa2
    has additional subdomain(s) that are not in the common domain

Details for d1wnsa1

PDB Entry: 1wns (more details), 3 Å

PDB Description: crystal structure of family b dna polymerase from hyperthermophilic archaeon pyrococcus kodakaraensis kod1
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d1wnsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wnsa1 c.55.3.5 (A:1-347) Exonuclease domain of family B DNA polymerases {Pyrococcus kodakaraensis [TaxId: 311400]}
mildtdyitedgkpvirifkkengefkieydrtfepyfyallkddsaieevkkitaerhg
tvvtvkrvekvqkkflgrpvevwklyfthpqdvpairdkirehpavidiyeydipfakry
lidkglvpmegdeelkmlafdietlyhegeefaegpilmisyadeegarvitwknvdlpy
vdvvsteremikrflrvvkekdpdvlityngdnfdfaylkkrceklginfalgrdgsepk
iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeavfgqpkekvyaeeittawe
tgenlervarysmedakvtyelgkeflpmeaqlsrligqslwdvsrs

SCOPe Domain Coordinates for d1wnsa1:

Click to download the PDB-style file with coordinates for d1wnsa1.
(The format of our PDB-style files is described here.)

Timeline for d1wnsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wnsa2