SCOPe 2.08: Domain d1wnsa1: 1wns A:1-347

Lineage for d1wnsa1 (1wns A:1-347)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
   contains Pfam PF00929

6. Protein Exonuclease domain of family B DNA polymerases [53125] (8 species)
   elaborated with additional structures and the N-terminal subdomain

7. Species Pyrococcus kodakaraensis [TaxId:311400] [53131] (2 PDB entries)
   Uniprot P56689 1-758 # 93% sequence identity; Thermococcus kodakarensis KOD1 TaxID: 69014
   additional N-terminal subdomain contains rudimental OB-fold but complete ferredoxin-like fold

8. Domain d1wnsa1: 1wns A:1-347 [109437]
   Other proteins in same PDB: d1wnsa2
   has additional subdomain(s) that are not in the common domain

Details for d1wnsa1

PDB Entry: 1wns, 3 Å

PDB Description: crystal structure of family b dna polymerase from hyperthermophilic archaeon pyrococcus kodakaraensis kod1

PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d1wnsa1:

Sequence; same for both SEQRES and ATOM records:

>d1wnsa1 c.55.3.5 (A:1-347) Exonuclease domain of family B DNA polymerases {Pyrococcus kodakaraensis [TaxId: 311400]}
mildtdyitedgkpvirifkkengefkieydrtfepyfyallkddsaieevkkitaerhg
tvvtvkrvekvqkkflgrpvevwklyfthpqdvpairdkirehpavidiyeydipfakry
lidkglvpmegdeelkmlafdietlyhegeefaegpilmisyadeegarvitwknvdlpy
vdvvsteremikrflrvvkekdpdvlityngdnfdfaylkkrceklginfalgrdgsepk
iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeavfgqpkekvyaeeittawe
tgenlervarysmedakvtyelgkeflpmeaqlsrligqslwdvsrs

Timeline for d1wnsa1:

• d1wnsa1 first appeared in SCOP 1.69
  
• d1wnsa1 appears in SCOPe 2.07