SCOPe 2.07: Domain d1wnja1: 1wnj A:4-145

Lineage for d1wnja1 (1wnj A:4-145)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.2: Cofilin-like [55762] (8 proteins)

6. Protein Coactosin-like protein Cotl1 (Clp) [111105] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [111107] (2 PDB entries)
   Uniprot Q14019

8. Domain d1wnja1: 1wnj A:4-145 [109436]
   Other proteins in same PDB: d1wnja2

Details for d1wnja1

PDB Entry: 1wnj

PDB Description: nmr structure of human coactosin-like protein

PDB Compounds: (A:) Coactosin-like protein

SCOPe Domain Sequences for d1wnja1:

Sequence; same for both SEQRES and ATOM records:

>d1wnja1 d.109.1.2 (A:4-145) Coactosin-like protein Cotl1 (Clp) {Human (Homo sapiens) [TaxId: 9606]}
matkidkeacraaynlvrddgsaviwvtfkydgstivpgeqgaeyqhfiqqctddvrlfa
fvrfttgdamskrskfalitwigenvsglqraktgtdktlvkevvqnfakefvisdrkel
eedfikselkkagganydaqte

Timeline for d1wnja1:

• d1wnja1 first appeared in SCOP 1.69, called d1wnja_
  
• d1wnja1 appears in SCOPe 2.06
  
• d1wnja1 appears in the current release, SCOPe 2.08