Lineage for d1wnja1 (1wnj A:4-145)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2534201Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2534202Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2534346Family d.109.1.2: Cofilin-like [55762] (8 proteins)
  6. 2534351Protein Coactosin-like protein Cotl1 (Clp) [111105] (2 species)
  7. 2534352Species Human (Homo sapiens) [TaxId:9606] [111107] (2 PDB entries)
    Uniprot Q14019
  8. 2534355Domain d1wnja1: 1wnj A:4-145 [109436]
    Other proteins in same PDB: d1wnja2

Details for d1wnja1

PDB Entry: 1wnj (more details)

PDB Description: NMR structure of human coactosin-like protein
PDB Compounds: (A:) Coactosin-like protein

SCOPe Domain Sequences for d1wnja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wnja1 d.109.1.2 (A:4-145) Coactosin-like protein Cotl1 (Clp) {Human (Homo sapiens) [TaxId: 9606]}
matkidkeacraaynlvrddgsaviwvtfkydgstivpgeqgaeyqhfiqqctddvrlfa
fvrfttgdamskrskfalitwigenvsglqraktgtdktlvkevvqnfakefvisdrkel
eedfikselkkagganydaqte

SCOPe Domain Coordinates for d1wnja1:

Click to download the PDB-style file with coordinates for d1wnja1.
(The format of our PDB-style files is described here.)

Timeline for d1wnja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wnja2