Lineage for d1wnia_ (1wni A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2529463Family d.92.1.9: Reprolysin-like [55519] (3 proteins)
    Pfam PF01421
  6. 2529468Protein Snake venom metalloprotease [55520] (7 species)
  7. 2529479Species Habu (Trimeresurus flavoviridis), Trimerelysin II [TaxId:88087] [111083] (1 PDB entry)
    Uniprot P20165
  8. 2529480Domain d1wnia_: 1wni A: [109435]
    complexed with zn

Details for d1wnia_

PDB Entry: 1wni (more details), 2.2 Å

PDB Description: crystal structure of h2-proteinase
PDB Compounds: (A:) Trimerelysin II

SCOPe Domain Sequences for d1wnia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wnia_ d.92.1.9 (A:) Snake venom metalloprotease {Habu (Trimeresurus flavoviridis), Trimerelysin II [TaxId: 88087]}
fpqryielaivvdhgmykkynqnsdkikvrvhqmvnhinemyrplniaislnrlqiwskk
dlitvksasnvtlesfgnwretvllkqqnndcahlltatnlndntiglaykkgmcnpkls
vglvqdyspnvfmvavtmthelghnlgmehddkdkckceacimsdvisdkpsklfsdcsk
ndyqtfltkynpqcilna

SCOPe Domain Coordinates for d1wnia_:

Click to download the PDB-style file with coordinates for d1wnia_.
(The format of our PDB-style files is described here.)

Timeline for d1wnia_: