SCOPe 2.08: Domain d1wnea1: 1wne A:1-470

Lineage for d1wnea1 (1wne A:1-470)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)

6. Protein Viral RNA polymerase [56695] (17 species)

7. Species Foot-and-mouth disease virus [TaxId:12110] [111302] (7 PDB entries)
   Uniprot Q9QCE4 1858-2327

8. Domain d1wnea1: 1wne A:1-470 [109434]
   Other proteins in same PDB: d1wnea2
   protein/DNA complex; protein/RNA complex; complexed with mg
   missing some secondary structures that made up less than one-third of the common domain

Details for d1wnea1

PDB Entry: 1wne, 3 Å

PDB Description: Foot and Mouth Disease Virus RNA-dependent RNA polymerase in complex with a template-primer RNA

PDB Compounds: (A:) RNA-dependent RNA polymerase

SCOPe Domain Sequences for d1wnea1:

Sequence; same for both SEQRES and ATOM records:

>d1wnea1 e.8.1.4 (A:1-470) Viral RNA polymerase {Foot-and-mouth disease virus [TaxId: 12110]}
glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh
kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp
walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri
vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd
ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc
satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl
gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti
qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgda

Timeline for d1wnea1:

• d1wnea1 first appeared in SCOP 1.69, called d1wnea_
  
• d1wnea1 appears in SCOPe 2.07