SCOP 1.71: Domain d1wncf_: 1wnc F:

Lineage for d1wncf_ (1wnc F:)

1. Root: SCOP 1.71

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.3: Coronavirus S2 glycoprotein [111474] (1 family)

5. Family h.3.3.1: Coronavirus S2 glycoprotein [111475] (1 protein)
   Pfam 01601

6. Protein E2 spike glycoprotein [111476] (2 species)

7. Species Human coronavirus strain SARS [111478] (3 PDB entries)

8. Domain d1wncf_: 1wnc F: [109433]

Details for d1wncf_

PDB Entry: 1wnc, 2.8 Å

PDB Description: crystal structure of the sars-cov spike protein fusion core

SCOP Domain Sequences for d1wncf_:

Sequence, based on SEQRES records:

>d1wncf_ h.3.3.1 (F:) E2 spike glycoprotein {Human coronavirus strain SARS}
nqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqllvprgsggsggs
gglevlfqgpdvdlgdisginasvvniqeeidrlnevaknlneslidl

Sequence, based on observed residues (ATOM records):

>d1wncf_ h.3.3.1 (F:) E2 spike glycoprotein {Human coronavirus strain SARS}
nqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqnasvvniqeeidr
lnevaknlneslidl

Timeline for d1wncf_:

• d1wncf_ first appeared in SCOP 1.69
  
• d1wncf_ appears in SCOP 1.73
  
• d1wncf_ appears in the current release, SCOPe 2.08