Lineage for d1wnce_ (1wnc E:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2646789Superfamily h.3.3: Coronavirus S2 glycoprotein [111474] (1 family) (S)
  5. 2646790Family h.3.3.1: Coronavirus S2 glycoprotein [111475] (1 protein)
    Pfam PF01601
  6. 2646791Protein E2 spike glycoprotein [111476] (2 species)
  7. 2646792Species Human coronavirus (strain SARS) [TaxId:227859] [111478] (9 PDB entries)
    Uniprot P59594 896-972,1142-1183
    Uniprot Q6UZF0 914-949,1148-1193
  8. 2646815Domain d1wnce_: 1wnc E: [109432]

Details for d1wnce_

PDB Entry: 1wnc (more details), 2.8 Å

PDB Description: crystal structure of the sars-cov spike protein fusion core
PDB Compounds: (E:) e2 glycoprotein

SCOPe Domain Sequences for d1wnce_:

Sequence, based on SEQRES records: (download)

>d1wnce_ h.3.3.1 (E:) E2 spike glycoprotein {Human coronavirus (strain SARS) [TaxId: 227859]}
nqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqllvprgsggsggs
gglevlfqgpdvdlgdisginasvvniqeeidrlnevaknlnesl

Sequence, based on observed residues (ATOM records): (download)

>d1wnce_ h.3.3.1 (E:) E2 spike glycoprotein {Human coronavirus (strain SARS) [TaxId: 227859]}
nqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqlinasvvniqeei
drlnevaknlnesl

SCOPe Domain Coordinates for d1wnce_:

Click to download the PDB-style file with coordinates for d1wnce_.
(The format of our PDB-style files is described here.)

Timeline for d1wnce_: