SCOP 1.69: Domain d1wnce_: 1wnc E:

Lineage for d1wnce_ (1wnc E:)

1. Root: SCOP 1.69

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.3: Coronavirus S2 glycoprotein (Pfam 01601) [111474] (1 family)

5. Family h.3.3.1: Coronavirus S2 glycoprotein (Pfam 01601) [111475] (1 protein)

6. Protein E2 spike glycoprotein [111476] (2 species)

7. Species Human coronavirus strain SARS [111478] (1 PDB entry)

8. Domain d1wnce_: 1wnc E: [109432]

Details for d1wnce_

PDB Entry: 1wnc, 2.8 Å

PDB Description: crystal structure of the sars-cov spike protein fusion core

SCOP Domain Sequences for d1wnce_:

Sequence, based on SEQRES records:

>d1wnce_ h.3.3.1 (E:) E2 spike glycoprotein {Human coronavirus strain SARS}
nqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqllvprgsggsggs
gglevlfqgpdvdlgdisginasvvniqeeidrlnevaknlnesl

Sequence, based on observed residues (ATOM records):

>d1wnce_ h.3.3.1 (E:) E2 spike glycoprotein {Human coronavirus strain SARS}
nqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqlinasvvniqeei
drlnevaknlnesl

Timeline for d1wnce_:

• d1wnce_ is new in SCOP 1.69
  
• d1wnce_ appears in SCOP 1.71
  
• d1wnce_ appears in the current release, SCOPe 2.08