Lineage for d1wncc_ (1wnc C:)

  1. Root: SCOP 1.73
  2. 752207Class h: Coiled coil proteins [57942] (7 folds)
  3. 753258Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 753491Superfamily h.3.3: Coronavirus S2 glycoprotein [111474] (1 family) (S)
  5. 753492Family h.3.3.1: Coronavirus S2 glycoprotein [111475] (1 protein)
    Pfam PF01601
  6. 753493Protein E2 spike glycoprotein [111476] (2 species)
  7. 753494Species Human coronavirus (strain SARS) [TaxId:227859] [111478] (9 PDB entries)
  8. 753515Domain d1wncc_: 1wnc C: [109430]

Details for d1wncc_

PDB Entry: 1wnc (more details), 2.8 Å

PDB Description: crystal structure of the sars-cov spike protein fusion core
PDB Compounds: (C:) e2 glycoprotein

SCOP Domain Sequences for d1wncc_:

Sequence, based on SEQRES records: (download)

>d1wncc_ h.3.3.1 (C:) E2 spike glycoprotein {Human coronavirus (strain SARS) [TaxId: 227859]}
qkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqllvprgsggsggsg
glevlfqgpdvdlgdisginasvvniqeeidrlnevaknlneslidlqel

Sequence, based on observed residues (ATOM records): (download)

>d1wncc_ h.3.3.1 (C:) E2 spike glycoprotein {Human coronavirus (strain SARS) [TaxId: 227859]}
qkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqinasvvniqeeidr
lnevaknlneslidlqel

SCOP Domain Coordinates for d1wncc_:

Click to download the PDB-style file with coordinates for d1wncc_.
(The format of our PDB-style files is described here.)

Timeline for d1wncc_: