SCOP 1.73: Domain d1wncb_: 1wnc B:

Lineage for d1wncb_ (1wnc B:)

1. Root: SCOP 1.73

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.3: Coronavirus S2 glycoprotein [111474] (1 family)

5. Family h.3.3.1: Coronavirus S2 glycoprotein [111475] (1 protein)
   Pfam PF01601

6. Protein E2 spike glycoprotein [111476] (2 species)

7. Species Human coronavirus (strain SARS) [TaxId:227859] [111478] (9 PDB entries)

8. Domain d1wncb_: 1wnc B: [109429]

Details for d1wncb_

PDB Entry: 1wnc, 2.8 Å

PDB Description: crystal structure of the sars-cov spike protein fusion core

PDB Compounds: (B:) e2 glycoprotein

SCOP Domain Sequences for d1wncb_:

Sequence, based on SEQRES records:

>d1wncb_ h.3.3.1 (B:) E2 spike glycoprotein {Human coronavirus (strain SARS) [TaxId: 227859]}
qkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqllvprgsggsggsg
glevlfqgpdvdlgdisginasvvniqeeidrlnevaknlneslidlqel

Sequence, based on observed residues (ATOM records):

>d1wncb_ h.3.3.1 (B:) E2 spike glycoprotein {Human coronavirus (strain SARS) [TaxId: 227859]}
qkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqisginasvvniqee
idrlnevaknlneslidlqel

Timeline for d1wncb_:

• d1wncb_ first appeared in SCOP 1.69
  
• d1wncb_ appears in SCOP 1.71
  
• d1wncb_ appears in SCOP 1.75
  
• d1wncb_ appears in the current release, SCOPe 2.08