SCOPe 2.07: Domain d1wnca_: 1wnc A:

Lineage for d1wnca_ (1wnc A:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.3: Coronavirus S2 glycoprotein [111474] (1 family)

5. Family h.3.3.1: Coronavirus S2 glycoprotein [111475] (1 protein)
   Pfam PF01601

6. Protein E2 spike glycoprotein [111476] (2 species)

7. Species Human coronavirus (strain SARS) [TaxId:227859] [111478] (9 PDB entries)
   Uniprot P59594 896-972,1142-1183
   Uniprot Q6UZF0 914-949,1148-1193

8. Domain d1wnca_: 1wnc A: [109428]

Details for d1wnca_

PDB Entry: 1wnc, 2.8 Å

PDB Description: crystal structure of the sars-cov spike protein fusion core

PDB Compounds: (A:) e2 glycoprotein

SCOPe Domain Sequences for d1wnca_:

Sequence, based on SEQRES records:

>d1wnca_ h.3.3.1 (A:) E2 spike glycoprotein {Human coronavirus (strain SARS) [TaxId: 227859]}
qkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqllvprgsggsggsg
glevlfqgpdvdlgdisginasvvniqeeidrlnevaknln

Sequence, based on observed residues (ATOM records):

>d1wnca_ h.3.3.1 (A:) E2 spike glycoprotein {Human coronavirus (strain SARS) [TaxId: 227859]}
qkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqinasvvniqeeidr
lnevaknln

Timeline for d1wnca_:

• d1wnca_ first appeared in SCOP 1.69
  
• d1wnca_ appears in SCOPe 2.06
  
• d1wnca_ appears in the current release, SCOPe 2.08