Lineage for d1wnca_ (1wnc A:)

  1. Root: SCOP 1.71
  2. 625746Class h: Coiled coil proteins [57942] (7 folds)
  3. 626649Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 626857Superfamily h.3.3: Coronavirus S2 glycoprotein [111474] (1 family) (S)
  5. 626858Family h.3.3.1: Coronavirus S2 glycoprotein [111475] (1 protein)
    Pfam 01601
  6. 626859Protein E2 spike glycoprotein [111476] (2 species)
  7. 626860Species Human coronavirus strain SARS [111478] (3 PDB entries)
  8. 626865Domain d1wnca_: 1wnc A: [109428]

Details for d1wnca_

PDB Entry: 1wnc (more details), 2.8 Å

PDB Description: crystal structure of the sars-cov spike protein fusion core

SCOP Domain Sequences for d1wnca_:

Sequence, based on SEQRES records: (download)

>d1wnca_ h.3.3.1 (A:) E2 spike glycoprotein {Human coronavirus strain SARS}
qkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqllvprgsggsggsg
glevlfqgpdvdlgdisginasvvniqeeidrlnevaknln

Sequence, based on observed residues (ATOM records): (download)

>d1wnca_ h.3.3.1 (A:) E2 spike glycoprotein {Human coronavirus strain SARS}
qkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqinasvvniqeeidr
lnevaknln

SCOP Domain Coordinates for d1wnca_:

Click to download the PDB-style file with coordinates for d1wnca_.
(The format of our PDB-style files is described here.)

Timeline for d1wnca_: