Lineage for d1wmzd_ (1wmz D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001355Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 3001440Protein Lectin CEL-I [111262] (1 species)
  7. 3001441Species Cucumaria echinata [TaxId:40245] [111263] (2 PDB entries)
    Uniprot Q7M462
  8. 3001447Domain d1wmzd_: 1wmz D: [109425]
    complexed with a2g, ca, nga

Details for d1wmzd_

PDB Entry: 1wmz (more details), 1.7 Å

PDB Description: crystal structure of c-type lectin cel-i complexed with n-acetyl-d- galactosamine
PDB Compounds: (D:) lectin CEL-I, N-acetyl-D-galactosamine-specific C-type

SCOPe Domain Sequences for d1wmzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wmzd_ d.169.1.1 (D:) Lectin CEL-I {Cucumaria echinata [TaxId: 40245]}
nqcptdweaegdhcyrffntlttwenahhecvsyscstlnvrsdlvsvhsaaeqayvfny
wrgidsqagqlwiglydkynegdfiwtdgskvgytkwaggqpdnwnnaedygqfrhtegg
awndnsaaaqakymckltfe

SCOPe Domain Coordinates for d1wmzd_:

Click to download the PDB-style file with coordinates for d1wmzd_.
(The format of our PDB-style files is described here.)

Timeline for d1wmzd_: