Lineage for d1wmzb_ (1wmz B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2607280Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2607365Protein Lectin CEL-I [111262] (1 species)
  7. 2607366Species Cucumaria echinata [TaxId:40245] [111263] (2 PDB entries)
    Uniprot Q7M462
  8. 2607368Domain d1wmzb_: 1wmz B: [109423]
    complexed with a2g, ca, nga

Details for d1wmzb_

PDB Entry: 1wmz (more details), 1.7 Å

PDB Description: crystal structure of c-type lectin cel-i complexed with n-acetyl-d- galactosamine
PDB Compounds: (B:) lectin CEL-I, N-acetyl-D-galactosamine-specific C-type

SCOPe Domain Sequences for d1wmzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wmzb_ d.169.1.1 (B:) Lectin CEL-I {Cucumaria echinata [TaxId: 40245]}
nqcptdweaegdhcyrffntlttwenahhecvsyscstlnvrsdlvsvhsaaeqayvfny
wrgidsqagqlwiglydkynegdfiwtdgskvgytkwaggqpdnwnnaedygqfrhtegg
awndnsaaaqakymckltfe

SCOPe Domain Coordinates for d1wmzb_:

Click to download the PDB-style file with coordinates for d1wmzb_.
(The format of our PDB-style files is described here.)

Timeline for d1wmzb_: