SCOP 1.69: Domain d1wmzb_: 1wmz B:

Lineage for d1wmzb_ (1wmz B:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (24 proteins)
   Pfam 00059

6. Protein Lectin CEL-I [111262] (1 species)

7. Species Cucumaria echinata [TaxId:40245] [111263] (2 PDB entries)

8. Domain d1wmzb_: 1wmz B: [109423]

Details for d1wmzb_

PDB Entry: 1wmz, 1.7 Å

PDB Description: crystal structure of c-type lectin cel-i complexed with n-acetyl-d- galactosamine

SCOP Domain Sequences for d1wmzb_:

Sequence; same for both SEQRES and ATOM records:

>d1wmzb_ d.169.1.1 (B:) Lectin CEL-I {Cucumaria echinata}
nqcptdweaegdhcyrffntlttwenahhecvsyscstlnvrsdlvsvhsaaeqayvfny
wrgidsqagqlwiglydkynegdfiwtdgskvgytkwaggqpdnwnnaedygqfrhtegg
awndnsaaaqakymckltfe

Timeline for d1wmzb_:

• d1wmzb_ is new in SCOP 1.69
  
• d1wmzb_ appears in SCOP 1.71
  
• d1wmzb_ appears in the current release, SCOPe 2.08