![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
![]() | Protein Lectin CEL-I [111262] (1 species) |
![]() | Species Cucumaria echinata [TaxId:40245] [111263] (2 PDB entries) Uniprot Q7M462 |
![]() | Domain d1wmzb_: 1wmz B: [109423] complexed with a2g, ca, nga |
PDB Entry: 1wmz (more details), 1.7 Å
SCOPe Domain Sequences for d1wmzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wmzb_ d.169.1.1 (B:) Lectin CEL-I {Cucumaria echinata [TaxId: 40245]} nqcptdweaegdhcyrffntlttwenahhecvsyscstlnvrsdlvsvhsaaeqayvfny wrgidsqagqlwiglydkynegdfiwtdgskvgytkwaggqpdnwnnaedygqfrhtegg awndnsaaaqakymckltfe
Timeline for d1wmzb_: