SCOP 1.71: Domain d1wmyb_: 1wmy B:

Lineage for d1wmyb_ (1wmy B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (26 proteins)
   Pfam 00059

6. Protein Lectin CEL-I [111262] (1 species)

7. Species Cucumaria echinata [TaxId:40245] [111263] (2 PDB entries)

8. Domain d1wmyb_: 1wmy B: [109421]
   complexed with ca, mpd

Details for d1wmyb_

PDB Entry: 1wmy, 2 Å

PDB Description: Crystal Structure of C-type Lectin CEL-I from Cucumaria echinata

SCOP Domain Sequences for d1wmyb_:

Sequence; same for both SEQRES and ATOM records:

>d1wmyb_ d.169.1.1 (B:) Lectin CEL-I {Cucumaria echinata}
nqcptdweaegdhcyrffntlttwenahhecvsyscstlnvrsdlvsvhsaaeqayvfny
wrgidsqagqlwiglydkynegdfiwtdgskvgytkwaggqpdnwnnaedygqfrhtegg
awndnsaaaqakymckltfe

Timeline for d1wmyb_:

• d1wmyb_ first appeared in SCOP 1.69
  
• d1wmyb_ appears in SCOP 1.73
  
• d1wmyb_ appears in the current release, SCOPe 2.08