SCOP 1.73: Domain d1wmya_: 1wmy A:

Lineage for d1wmya_ (1wmy A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (8 families)

5. Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
   Pfam PF00059

6. Protein Lectin CEL-I [111262] (1 species)

7. Species Cucumaria echinata [TaxId:40245] [111263] (2 PDB entries)

8. Domain d1wmya_: 1wmy A: [109420]

Details for d1wmya_

PDB Entry: 1wmy, 2 Å

PDB Description: Crystal Structure of C-type Lectin CEL-I from Cucumaria echinata

PDB Compounds: (A:) lectin CEL-I, N-acetyl-D-galactosamine-specific C-type

SCOP Domain Sequences for d1wmya_:

Sequence; same for both SEQRES and ATOM records:

>d1wmya_ d.169.1.1 (A:) Lectin CEL-I {Cucumaria echinata [TaxId: 40245]}
nqcptdweaegdhcyrffntlttwenahhecvsyscstlnvrsdlvsvhsaaeqayvfny
wrgidsqagqlwiglydkynegdfiwtdgskvgytkwaggqpdnwnnaedygqfrhtegg
awndnsaaaqakymckltfe

Timeline for d1wmya_:

• d1wmya_ first appeared in SCOP 1.69
  
• d1wmya_ appears in SCOP 1.71
  
• d1wmya_ appears in SCOP 1.75
  
• d1wmya_ appears in the current release, SCOPe 2.08