SCOP 1.73: Domain d1wmxb_: 1wmx B:

Lineage for d1wmxb_ (1wmx B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (30 families)

5. Family b.18.1.24: Family 30 carbohydrate binding module, CBM30 (PKD repeat) [110125] (1 protein)

6. Protein Endoglucanase CelJ [110126] (1 species)

7. Species Clostridium thermocellum [TaxId:1515] [110127] (3 PDB entries)

8. Domain d1wmxb_: 1wmx B: [109419]
   complexed with so4

Details for d1wmxb_

PDB Entry: 1wmx, 2 Å

PDB Description: Crystal Structure of Family 30 Carbohydrate Binding Module

PDB Compounds: (B:) COG3291: FOG: PKD repeat

SCOP Domain Sequences for d1wmxb_:

Sequence; same for both SEQRES and ATOM records:

>d1wmxb_ b.18.1.24 (B:) Endoglucanase CelJ {Clostridium thermocellum [TaxId: 1515]}
gyrklldvqifkdspvvgwsgsgmgeletigdtlpvdttvtynglptlrlnvqttvqsgw
wislltlrgwnthdlsqyvengylefdikgkeggedfvigfrdkvyervygleidvttvi
snyvtvttdwqhvkiplrdlmkinngfdpssvtclvfskryadpftvwfsdikitsedne
ksapaikvnqlgfip

Timeline for d1wmxb_:

• d1wmxb_ first appeared in SCOP 1.69
  
• d1wmxb_ appears in SCOP 1.71
  
• d1wmxb_ appears in SCOP 1.75
  
• d1wmxb_ appears in the current release, SCOPe 2.08