Lineage for d1wmxb_ (1wmx B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774862Family b.18.1.24: Family 30 carbohydrate binding module, CBM30 (PKD repeat) [110125] (2 proteins)
  6. 2774863Protein Endoglucanase CelJ [110126] (1 species)
  7. 2774864Species Clostridium thermocellum [TaxId:1515] [110127] (2 PDB entries)
    Uniprot P71140 34-228 # chain B coverage
  8. 2774866Domain d1wmxb_: 1wmx B: [109419]
    complexed with so4

Details for d1wmxb_

PDB Entry: 1wmx (more details), 2 Å

PDB Description: Crystal Structure of Family 30 Carbohydrate Binding Module
PDB Compounds: (B:) COG3291: FOG: PKD repeat

SCOPe Domain Sequences for d1wmxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wmxb_ b.18.1.24 (B:) Endoglucanase CelJ {Clostridium thermocellum [TaxId: 1515]}
gyrklldvqifkdspvvgwsgsgmgeletigdtlpvdttvtynglptlrlnvqttvqsgw
wislltlrgwnthdlsqyvengylefdikgkeggedfvigfrdkvyervygleidvttvi
snyvtvttdwqhvkiplrdlmkinngfdpssvtclvfskryadpftvwfsdikitsedne
ksapaikvnqlgfip

SCOPe Domain Coordinates for d1wmxb_:

Click to download the PDB-style file with coordinates for d1wmxb_.
(The format of our PDB-style files is described here.)

Timeline for d1wmxb_: